PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim11g068750.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 453aa    MW: 51631.1 Da    PI: 9.1611
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim11g068750.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.61.3e-49822081128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                         + pGfrF Ptdeel+++yLkkkveg++  + evi+ev+i k+ePwdLp k++ ++++ew+fFs+r +ky++g++++rat+sgyWkatgk++
  Sopim11g068750.0.1  82 MFPGFRFCPTDEELISYYLKKKVEGSDKCV-EVISEVEIWKHEPWDLPgKSIVQSDNEWFFFSPRGRKYPNGSQSKRATESGYWKATGKER 171
                         579************************777.99***************878888999********************************** PP

                 NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +v+s +++ +g+k+tLvf+ grapkg++t+W+mhey +
  Sopim11g068750.0.1 172 NVKS-GTNIIGTKRTLVFHIGRAPKGQRTQWIMHEYCM 208
                         ****.999****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-5679225IPR003441NAC domain
PROSITE profilePS5100553.67982226IPR003441NAC domain
PfamPF023651.1E-2684207IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MIHPFKFFKY FFLTRQSDLY KLLKYCYFLG LKKLEKKFVF GVMEDEDLLG CNSEKKNGEI  60
IEKTKISNSN GVEISVATAS TMFPGFRFCP TDEELISYYL KKKVEGSDKC VEVISEVEIW  120
KHEPWDLPGK SIVQSDNEWF FFSPRGRKYP NGSQSKRATE SGYWKATGKE RNVKSGTNII  180
GTKRTLVFHI GRAPKGQRTQ WIMHEYCMTA NPLYQDSMVV CRLRKNNEFH LNDTPGNQRN  240
DLAVTNGTVD LSRAVQLNGL GLINGGECCS KEASSSFSSH SVEQIESGSE SDKLNKELPQ  300
HHSSSHWKDC DEEDCFADIM KDDIIKLDDS SYKAKHNLLP TITRKLESST KSPTSQEAQN  360
LMSNRLPFQG TANRRLKLQT EKVPRGVETL ELHEANKKNI HARGISRRLI NIAPVKRMKQ  420
WSIPLLLISL MLLIVLLCLF GVPQPVKWHY SS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-43732258164NAC domain-containing protein 19
4dul_A3e-43732258164NAC domain-containing protein 19
1ut7_B3e-43732258164NO APICAL MERISTEM PROTEIN
1ut7_A3e-43732258164NO APICAL MERISTEM PROTEIN
1ut4_B3e-43732258164NO APICAL MERISTEM PROTEIN
1ut4_A3e-43732258164NO APICAL MERISTEM PROTEIN
3swp_D4e-437322511167NAC domain-containing protein 19
3swp_C4e-437322511167NAC domain-containing protein 19
3swp_B4e-437322511167NAC domain-containing protein 19
3swp_A4e-437322511167NAC domain-containing protein 19
3swm_D4e-437322511167NAC domain-containing protein 19
3swm_C4e-437322511167NAC domain-containing protein 19
3swm_B4e-437322511167NAC domain-containing protein 19
3swm_A4e-437322511167NAC domain-containing protein 19
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755230.0HG975523.1 Solanum lycopersicum chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004251082.20.0PREDICTED: NAC domain-containing protein 89-like
TrEMBLK4DA320.0K4DA32_SOLLC; Uncharacterized protein
STRINGSolyc11g068750.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.18e-77NTM1-like 8